Is Liquid Web currently down? Live Status and Outage Reports

Scroll down

Marho @azanor

Reported 2021-10-15 13:53:09

@LiquidWeb @nexcess @TheEventsCal @LearnDashLMS @stellarwp @mic****eames @renewabelle @WadeWachs @ecalley @kronberg12 @TravisJacobson @BrandSanderson's #Mistborn trilogy! Hands down !!

Ravi Jayagopal @RaviJayagopal

Reported 2021-10-11 21:46:29

@benUNC If a bug in your s/w causes some kind of inconvenience to the customer in their business - like, error in reporting, billing, or to their users, apologizing for the bug is the right thing to do. Then, you have to quickly fix it too. Disappointed to see this attitude at LiquidWeb.

Guru99.com @guru99com

Reported 2021-10-11 00:15:59

@LiquidWeb Can you have some senior/experienced expert look into ticket # 09574530 ... website going down has become very very frequent... thinking of switching host

David Bisset @dimensionmedia

Reported 2021-10-04 15:31:55

OH: “Facebook when down and by instinct all I could think about was who acquired them: @LiquidWeb @automattic or @AwesomeMotive."

Adel Alawi @adel_alawi

Reported 2021-10-03 14:46:21

@LiquidWeb my website is down more than 10 hours and you promised to bring it up in 30 minutes and it’s still down because of your demand for the ransom money

Adel Alawi @adel_alawi

Reported 2021-10-03 14:33:52

@LiquidWeb be careful when dealing with this company they will bring your website down and then ask for ransom

Harry Potter @harryvani

Reported 2021-10-01 15:39:10

@liquidweb It is 14 hours since customer site is down due to entirely your fault of installing Secure Server Plus on server by probably unskilled technicians. #liquidweb #secureserver #secureserverplus

Harry Potter @harryvani

Reported 2021-10-01 11:47:47

@LiquidWeb Customer's account id is #329114 Ticket 09545647 Customer says - Site has been down for 11 hours and this is entirely and fully due to Liquidweb security team screwing up SS+ Install. And you don't even have a plan to bring it back to pre-install stage snapshot

Harry Potter @harryvani

Reported 2021-10-01 09:17:09

@LiquidWeb - Post SS+ Install, a high traffic real estate website has been down on #liquidweb for over 8 hours. They never validated post secure install that their SS+ install with bring down the site and just closed the ticket. #liquidweb #SS+ #security #secureserverplus

Minister of Light 🇳🇬 (Sam Iso) @sam_iso_o

Reported 2021-09-30 20:27:50

Enaira website Tools used Next.js + React static site generator Apollo GraphQL Cloudfare CDN GoDaddy (domain NS) Web Server: nginx/Apache/CentOs Liquid Web(Dedicated Hosting) Problem: likely domain name not resolving #enaira

Minister of Light 🇳🇬 (Sam Iso) @sam_iso_o

Reported 2021-09-30 20:26:47

Enaira website Tools used Next.js + React static site generator Apollo GraphQL Cloudfare CDN GoDaddy (domain NS) Web Server: nginx/Apache/CentOs Liquid Web(Dedicated Hosting) Problem: likely domain name not resolving #enaira #cbn

Mickel @Mickael513

Reported 2021-09-28 02:18:20

Marché Equilibrio de carga Herramientas 2021 : technologies tendances, croissance du ... Apsis IT Security Cedexis ManageEngine HAProxy Technologies Loadbalancer ... Liquid Web Citrix Systems EdgeNEXUS. Inlab Networks INetFusion. https://t.co/Gwtn99akqE #cybersecurity

Liquid Web @LiquidWeb

Reported 2021-09-15 10:00:26

Rory and team can help you find the cause of the problem! #IWOCK #IWishOurCustomersKnew #IWOCKWednesday #LiquidWebIWOCK https://t.co/gWemprtec6

Guru99.com @guru99com

Reported 2021-09-13 02:10:24

@LiquidWeb Still your team has not been able to resolve the issue

Do the Woo 🎙️ WooCommerce Builder Community @DotheWoo

Reported 2021-09-08 18:37:50

Hey all. Site is down. SSL reconfiguration failed. But my friends @LiquidWeb are on it :)

kazmi 🇵🇰 @syed_jawadkazmi

Reported 2021-08-28 09:04:48

Hi @LiquidWeb , I had reported a vulnerability in liquidweb bug bounty program on March 9 2021. Still liquidweb team is saying there devs are working to remedy this issue. If your developers are able to reproduce bug, why I'm not getting reward. Thanks #BugBounty #liquidweb https://t.co/g8imBT12tO

Liquid Web @LiquidWeb

Reported 2021-08-27 09:00:23

Carley Johnson, Liquid Web’s Marketing Web and Content Specialist, on accessibility, problem solving, and joining the world of tech. https://t.co/RKVzLZ9TTI https://t.co/Plo5XubhRd

WP-Content.co @wpcontent_co

Reported 2021-08-24 09:44:04

#Newsletter Issue #31 👉 https://t.co/hYPL2k1BEx “WP” trademark confusion, #Gutenberg release & more updates Deals @envato, @Cloudways, @LiquidWeb, @DreamHost, @HostSoch, @HostPapa Sponsored by @wpjobopenings 😍 Subscribe for more👉 https://t.co/1LmRSwUxme #WordPressNews https://t.co/f5RxQHJQeI

Mosses Akizian @monocat

Reported 2021-08-19 12:28:33

Got a site to launch? Need hosting but not sure what type. Here's a simple write-up that breaks down different types of hosting. Happy reading! https://t.co/o5IyD75e9h @LiquidWeb @nexcess

Liquid Web @LiquidWeb

Reported 2021-08-03 17:11:08

I wish people knew that sometimes what they think is the problem... isn't. #IWOCK #LiquidWeb #MostHelpfulHumansInHosting #FocusOnYourBusiness #WeHandleTheRest https://t.co/WswGFQ7zwK

Justin Horn @justin_horn

Reported 2021-08-03 10:01:22

@Dougboss @SmackDigital @steadfastnet Now that I've got to sleep on it, not sure what I'm going to do. I am very disappointed with the lack of communication during the outage, which is why I created an account at Liquid Web in the first place, I didn't want to go to sleep last night with all my sites still being down

plum @chrisplummer

Reported 2021-07-30 18:53:50

hey @LiquidWeb, shut this phish down? hxxps://safelinks.familymediterraneanpizza.com https://t.co/K9v1vSSlxV

Benjamin Fletcher @SidelineAff

Reported 2021-07-28 17:08:06

@LukeKling @digitalocean This is who you want. @BigScoots straight up best web host hands down and that's coming from somebody who was previously on Liquid Web.

Michelle Frechette - Black Lives Matter ✊🏾 @michelleames

Reported 2021-07-26 08:39:01

Friday, during WordFest, this post came out & although I did share it, I was in the middle of about 46 hours without sleep, so I want to say again how much I love working at @GiveWP & #TeamGive & also how welcoming & amazing @LiquidWeb has been since we joined them. #HappyBlessed

Joe Oesterling @joeoesterling

Reported 2021-07-23 17:59:39

We are so fortunate to have added @mic****eames from @GiveWP to the @stellarwp team inside of @LiquidWeb this year. She is a great employee, a phenomenal amb***ador inside #WordPress, and she is a delightful human being!

Anne Marie O'Sullivan @AnneMarieOSull9

Reported 2021-07-19 04:55:03

@CiryMarr @aciquestion @ekg2009 @LiquidWeb They didn't terminate her a/c. Gemma owns that website so long as she pays the rent for it. She took it down herself this is my guess

Freelance Jobs Feed @FreelanceJobRSS

Reported 2021-07-09 07:00:08

#CSS #HTML fix woocommerce issue cart page not showing contents: I have a website I have transferred from liquidweb to cloudways. Stuff appears to be entered in the cart but when I click on the cart it says "your cart is empty" Its latest woocommerce… https://t.co/T81ntZtzBq

BootstrapZero @BootstrapZero

Reported 2021-07-01 07:09:03

@LiquidWeb This outage this AM is terrible. Servers offline, no timeline, no supervisors available. Terrible way to treat customers!

Grant Austin @TheGrantAustin

Reported 2021-06-26 17:36:24

Facebook memories has shown I have been with @liquidweb for 12 years. Hands down best decision I made, but wish they would still send me swag. I still rock the hockey jersey and have at least one hero left.

FindTape.com @FindTape

Reported 2021-06-23 17:26:07

We migrated our servers from @HostDime to @LiquidWeb because of supposed better #support, but our site has been down for hours and @LiquidWeb support has been absolutely horrendous. Never have experienced anything like this in 20 years.

Michelle Schulp 💯🦄 @marktimemedia

Reported 2021-06-23 13:35:58

@LiquidWeb @ShawnHooper Appreciate it! If the person working with the client isn't able to resolve the issue, I'll be sure to do so.

WP Owls @WP_Owls

Reported 2021-06-18 04:09:09

💚 The #guesteditor for issue 38 of WP Owls is @chrislema! He is a daily blogger at https://t.co/0faJCTmQn2 and the VP of Products at @liquidweb. A regular and popular #speaker at #WordCamps for the last decade. https://t.co/qAqwX0Zlkw #WordPress #wordpressdeveloper #developer https://t.co/qihgdWFTH4

Veena Prashanth @veenap

Reported 2021-06-16 22:05:01

@LiquidWeb - our main site has been down for 20 hours now. Unfortunately, now all the other sites (on other servers) have gone down as well. What's going on?

Ravi Jayagopal @RaviJayagopal

Reported 2021-06-16 21:59:37

@LiquidWeb Closing in on 21 hours and our website still down. Your own website appears to be down (not home page, but when trying to log in to account - doesn't load). Also, it's not about giving us 10x credit for downtime (per server hour). It's about lost customers, credibility, sales...

Ravi Jayagopal @RaviJayagopal

Reported 2021-06-16 17:42:00

.@liquidweb our site has been down for over 15 hrs (supposed to be a simple 10-min sched maint). Your support is great, but service has gradually gotten worse over the years. Never gotten more site-down notifications frm automated monitoring like this past yr. Very disappointed.

Veena Prashanth @veenap

Reported 2021-06-16 17:12:19

@LiquidWeb Thanks. Site has been down for 14+ hours now. It's still down. This does not just impact our business. It directly impacts our customers (and we recommend LW to our customers). Didn't see this coming after a scheduled maintenance.

Veena Prashanth @veenap

Reported 2021-06-16 15:49:43

I used to be a fan of LiquidWeb support but very frustrated today with their lack of preparedness for things going wrong with a scheduled maintenance. Site down from 13 hours. Hundreds of customers impacted. Totally frustrated with support or lack thereof.

J-T Richards @JT_Richards

Reported 2021-06-15 10:03:58

@topher1kenobe @LiquidWeb Yes, I did, but their implementation appears to be broken, thus necessitating your hack.

J-T Richards @JT_Richards

Reported 2021-06-15 09:38:13

@topher1kenobe @LiquidWeb "Oh, and we have this feature that's missing a ton of useful features, but it's there if you want a broken feature." It sounds like a spreadsheet that's limited to addition and subtraction—no multiplication or division—and doesn't allow negative numbers. But hey! Spreadsheet!

Gabriela Linares MSc. @gabylinares

Reported 2021-06-14 23:52:12

@atjuch @chrislema @jilt @GoDaddy @LiquidWeb @nexcess @stellarwp I've been with @GoDaddy for years and now my site is suddenly not working. It's an issue on their servers which they won't fix. What hosting service do you recommend?

Leanne Mitton @LeanneMitton

Reported 2021-06-09 18:18:30

@pgrahamstrong @rmors_ I have a dedicated server through Liquid Web. There's no caching set up. I have run into the Siteground issue before though.

Dave Rodenbaugh @daverodenbaugh

Reported 2021-06-08 18:51:37

If you're on #WooCommerce or #EDD and are a Jilt customer, we can help migrate you to @recaptureio for free (concierge service!) so you won't miss a beat. As @nexcess and @LiquidWeb partners we're committed to your store's success.

Gasper rubino @Gaspertweets

Reported 2021-06-08 13:38:54

@nexcess: RT @chrislema: Today @jilt announced they were closing things down in 2022. I fully believe smart people there and @GoDaddy evaluated that decision carefully. But it’s a risk with any acquisition. It’s why our commitment at @LiquidWeb / @nexcess / @stellarwp up fro…

Chris Lema @chrislema

Reported 2021-06-08 12:31:03

Today @jilt announced they were closing things down in 2022. I fully believe smart people there and @GoDaddy evaluated that decision carefully. But it’s a risk with any acquisition. It’s why our commitment at @LiquidWeb / @nexcess / @stellarwp up front is to keep brands alive.

Chris Lema @chrislema

Reported 2021-06-08 12:18:02

At @nexcess / @LiquidWeb we’ve already started bringing new #WooCommerce customers to @recaptureio. We’ll work with existing to get existing customers over. Chat with @renewabelle.

Abhi Dwivedi @lazyabhi

Reported 2021-06-05 06:26:44

@LiquidWeb sent a DM. Not getting any joy from the support team on a critical issue.

Adam J. Humphreys @Making8

Reported 2021-06-03 04:27:59

@chrislema @iconicwp @LiquidWeb @stellarwp Is there any plans to not have $200 per month woocommerce plans and come down to Shopify level pricing or lower? For brand new sites for instance veterans just learning to do online e-commerce this is insane. I host them myself on a VPS because I know they can’t afford it.

The Repository @therepositorywp

Reported 2021-05-14 08:00:07

It's Friday 😌 Finish your week with #TheRepository & get a round-up of #WordPress news 🗞️ Issue #74 covers: 🙅🏼‍♀️ Accessibility advocates sign open letter opposing overlays 💰 @LiquidWeb acquires @GiveWP 💸 Genesis Framework will soon be free Hope you have a great weekend! 🧡

Adam Nolan @MrAdamNolan

Reported 2021-05-05 18:23:03

@LiquidWeb Since you decided to remove the negative review that @RobertStukes left I figure I'd leave mine. Support at LW is TERRIBLE the past few years. They do the absolute bare minimum, take days to respond, have lied to me multiple times and try to sell instead of fixing the problem.

Robert Stukes @RobertStukes

Reported 2021-05-05 16:57:22

@LiquidWeb Hey @LiquidWeb funny you should post this when my support ticket [Ticket #: 08352089] has been p***ed kicked down the chain to 3 different techs in 48 hours with nothing done except an offered upsell, which I took and then...crickets...What gives?

Is Liquid Web down right now?

Liquid Web Problem Reports

Liquid Web Latest Reports

Liquid Web Comments